Frameshift Mutation

Thus a frameshift mutation (from either deletion or insertion) frequently results in a protein that is a different length than the original protein, with a new section of seemingly random amino acids attached to the stop of the protein that take zip to exercise with the sequence of amino acids that was at that place before.

From: The Human Genome (Third Edition) , 2011

Hemoglobinopathies and Thalassemias

John Onetime , in Emery and Rimoin's Principles and Practice of Medical Genetics, 2013

71.nine.4.iv Frameshift Mutations

Frameshift mutations are deletions or additions of one, 2, or 4 nucleotides that change the ribosome reading frame and cause premature termination of translation at a new nonsense or chain termination codon (TAA, TAG, and TGA). Likewise, insertions, deletions, and bespeak mutations tin all generate a nonsense codon mutation, directly stopping translation. Chain termination mutations issue in the majority of cases in a shortened β-mRNA that is often unstable and is rapidly degraded. The majority of these mutations that occur within exons 1 and 2 results in the typical recessively inherited β o-thalassemia phenotype. In contrast, frameshift and nonsense mutations that occur later in the β-globin sequence in exon three frequently produce a clinical phenotype more astringent than typical β-thalassemia trait and are said to be dominantly inherited.

Read full chapter

URL:

https://www.sciencedirect.com/science/article/pii/B9780123838346000756

Protein Synthesis and Degradation

John Due west. Pelley , in Elsevier'south Integrated Review Biochemistry (Second Edition), 2012

Frameshift Mutations

Frameshift mutations are produced by molecules that can insert (intercalate) betwixt the normal bases to create mistakes during DNA synthesis. These are usually flat molecules, such as the acridine dyes, that accept a hydrophobic nature (remember that hydrophobic base stacking is a contributing force in the construction of the helix). A frameshift mutation is produced either by insertion or deletion of one or more new bases. Because the reading frame begins at the starting time site, any mRNA produced from a mutated Dna sequence will be read out of frame after the bespeak of the insertion or deletion, yielding a nonsense protein. Similarly to a point mutation, a frameshift mutation can produce a termination codon ( Fig. 17-7). In improver, frameshift mutations, similar indicate mutations, are less deleterious if they are close to the carboxyl terminal.

Histology

Continuously Dividing Cells

Cells undergoing continuous prison cell segmentation are either differentiating mitotic cells or vegetative intermitotic cells (stem cells) that replicate both to replace themselves and to provide precursors for specialized cells. Examples of stem cells are basal cells in the epidermis, regenerative cells in the intestines, and os marrow stalk cells. Examples of differentiating mitotic cells are the prickle cells in the stratum spinosum of the epidermis and fibroblasts in the connective tissue during wound healing.

Recombination Mutations

Recombination is a normal process through which chromosomes commutation gene alleles (alternative forms of the same gene). When it occurs during meiosis, it is referred to as crossing over. During this process, genes are not created or destroyed, simply if a misalignment occurs (Fig. 17-8), then an unequal distribution of DNA results. This creates a deletion from the affected factor on one strand accompanied by a partial duplication on the other strand. When this blazon of unequal crossover occurs during meiosis, the new chromosomal arrangement becomes a heritable modify. An example of such an unequal crossover is the Lepore thalassemia variant allele (Fig. 17-9). The similarity between the β-globin gene and the adjacent δ-globin gene led to a misalignment and an unequal crossover within the gene. Since the δ-globin protein has normal function in forming active hemoglobin tetramers, there is no loss of function from this mutation. Instead, the defect is in the fact that the hybrid δ-β globin, which is the aforementioned length every bit the normal β-globin, is produced by the slower δ-globin promoter, thus classifying the mutation as a thalassemia (reduced production of a globin leading to altered hemoglobin tetramers).

Fundamental Point Nearly Mutation

▪

The outcome of a mutation can range from silence to destruction of the polypeptide or deletion of the gene; the result of the mutation is determined by where in the mRNA the change occurred and what the new codon specifies (e.g., a termination codon vs. an amino acid change).

Read full chapter

URL:

https://www.sciencedirect.com/science/commodity/pii/B9780323074469000179

Epithelial Neoplasms of the Large Intestine

Mark REDSTON , in Surgical Pathology of the GI Tract, Liver, Biliary Tract, and Pancreas (Second Edition), 2009

Microsatellite Instability Testing

Frameshift mutations in microsatellites can be identified by extraction of DNA from both normal and tumor tissue (usually paraffin-embedded tissue), amplification of selected microsatellites past PCR, and assay of fragment size past gel electrophoresis or an automated sequencer ( Fig. 23-28). Criteria have been developed to standardize the molecular classification of microsatellite instability 222 (Tabular array 23-19) using either a Bethesda consensus–defined panel of microsatellites 222 or a revised panel that uses more mononucleotide markers. 223 The sensitivity of the revised panel of microsatellite instability testing is at least ninety%. Merely occasional tumors from patients with known pathogenic mismatch repair cistron mutations are MSS. 223 The specificity of the revised panel is also very high. The absence of mutations in up to 20% of HNPCC families with MSI-H tumors is believed to exist due to a failure to detect unusual germline variants. 211 , 212 The sensitivity and specificity of the original Bethesda panel are lower owing to the failure of dinucleotide, trinucleotide, and tetranucleotide markers to detect mismatch repair–deficient tumors, and misclassification of MSI-Fifty tumors because of fake-positive results using the same molecular markers.

Read full chapter

URL:

https://www.sciencedirect.com/science/article/pii/B9781416040590500266

Compensatory Evolution

N. Osada , in Encyclopedia of Evolutionary Biology, 2016

Intramolecular Compensatory Development

Frameshift mutations are i of the examples of intramolecular compensation. However, there are many other mechanisms that promote intramolecular compensatory evolution. Ane of the clearest show of intramolecular compensatory evolution has been described in stem-loop structures in RNA molecules ( Wheeler and Honeycutt, 1988). Every bit shown in Effigy ii, transcribed RNA molecules often grade Watson–Crick pairs between A and U bases, and between C and 1000 bases, in stem-loop structure. Mutations in i strand would dismiss the pairing and secondary structure of the RNA molecules may go unstable or may shift to a dissimilar state. However, if the base coding the opposite strand have some other mutation that could course correct pairing, the two ribonucleotides could form proper pairing again. Many RNA structures such every bit tRNA and ribosomal RNA structure have the potential to promote compensatory evolution, and studies take shown that compensatory evolution is a prevalent mode of RNA sequence evolution (Wheeler and Honeycutt, 1988; Stephan and Kirby, 1993; Meer et al., 2010).

Figure 2. Example of compensatory evolution in RNA stalk-loop structure. Watson and Crick pairs bound with each other with hydrogen bonds. Change of RNA sequence from G to C in the stem region (which is C to M mutation in the coding strand of genome) would break up the coupling, but the bond could be restored past boosted mutation in the opposite strand.

Proteins are folded into complex three-dimensional structures and many amino acid residues interact with one another in the folding process, which provide huge opportunity for compensatory development between different amino acid sites (DePristo et al., 2005). For example, positively charged amino acid site and negatively charged amino acrid sites that are physically close to each other are bound with electrostatic interaction. Change of the i amino acid to lose proper charge may disrupt the interaction and may exist detrimental for protein folding and stability, but the stability may exist recovered by paired alter at interacting sites. Complex protein structure offers large potential for other kinds of interaction between amino acid sites, such every bit hydrophobic interactions and covalent bonds between amino acid residues (reviewed in Ivankov et al., 2014). In laboratory experiments, many compensatory mutations that could affect the stabilization of proteins have been identified (Lunzer et al., 2010). Notation that compensatory development here is not restricted to 2-locus interaction as presented in the simple population genetics model. Indeed, experimental show showed that the issue of deleterious mutations are often compensated by many dissimilar mutations effectually deleterious mutations (eastward.g., Poon and Chao, 2005). In addition, many molecular evolution studies accept identified coupled amino acid substitutions along lineages especially when the coevolving sites are close in three-dimensional structure (e.k., Shim et al., 2005; Wang and Pollock, 2007; Yeang and Haussler, 2007). Large part of these correlated amino acid substitutions could be due to compensatory evolution.

Another example of intermolecular compensatory evolution is the evolution of codon bias (Akashi, 1995). In many genomes, both in eukaryotes and prokaryotes, the preference of codon usage in degenerative codons has been observed and preferred codons often correspond to the well-nigh abundant tRNA in the genomes (Ikemura, 1981). The frequency of preferred codons would be different among genes and correlate with gene expression level (Duret and Mouchiroud, 1999). Considering the selective effect of each codon is presumably weak and one gene harbors many degenerative codons, proceeds and loss of preferred codons within genes are considered to be evolving under compensatory weak option evolution. Population genetics studies on codon usage bias in Drosophila showed that the forcefulness of natural selection was indeed very weak and in the range of weak pick (|Nes|~i) (Akashi, 1995). Similar argument could be applied to the development of nucleosome bounden sites, where nucleotide A and T are preferred for nucleosome bounden and GC content at genome-broad level is nether compensatory weak option (Kenigsberg et al., 2010).

Read total affiliate

URL:

https://world wide web.sciencedirect.com/science/article/pii/B9780128000496001748

Proteases in Health and Disease

Stefano Lancellotti , Raimondo De Cristofaro , in Progress in Molecular Biological science and Translational Science, 2011

2 Frameshift Mutations

In v frameshift mutations, c.1783_1784del, c.2376_2401del, c.2549_2550del, c.3770dupT, and c.4143dupA, ADAMTS13 is expressed every bit a truncated mutant with an aberrant C-last end. The c.1783_1784del mutation replaces L595-T1427 sequence in the spacer domain with the peptide sequence dGGEDRRALCRGWEDEHLP, the c.2376_2401del mutation in the TSP1-4 domain (A793-T1427) with the sequence PALPCQVGGVRAQLMHISWWSRPGLGERDLCARGRWPGGSSD, the c.2549_2550del mutation in the TSP1-5 domain (D850-T1427) with the GEAACP sequence, the c.3770dupT in the CUB-1 domain (L1258-T1427) with VGHDFQL QDQHAGGEAALRAARRWGAAAVWEPACS, and the c.4143dupA frameshift mutation in the CUB-2 domain (E1382-T1427) with the REQPG sequence. These aberrant mutants cannot be secreted, whereas others are secreted in sufficient amounts but are dysfunctional. However, it cannot exist excluded that mRNAs with these frameshift mutations may exist eliminated by gene expression quality command systems. Finally, information technology should be noted that the c.3254_3255del mutation, which is responsible for the built thrombotic thrombocytopenic purpura called Upshaw–Schulman syndrome, is often reported in the literature equally the R1096X mutation. 98

Read full chapter

URL:

https://www.sciencedirect.com/science/article/pii/B9780123855046000038

Dystonia

Marker S. LeDoux , in Movement Disorders (Second Edition), 2015

24.half dozen.ane.iii DYT10/DYT19 (PKD)

Numerous missense and frameshift mutations leading to protein truncation or nonsense-mediated decay in the gene for proline-rich transmembrane protein 2 ( PRRT2) take been associated with PKD in numerous Han Chinese, Caucasian, and African-American families (Chen et al., 2011; Li et al., 2012; Liu et al., 2012; Wang et al., 2011). Several of the frameshift mutations are predicted to cause poly peptide truncation or nonsense-mediated disuse (Hedera et al., 2012). PRRT2 contains two predicted transmembrane domains and is highly expressed in the developing nervous system, particularly the cerebellum (Chen et al., 2011). In addition to archetype carbamazepine-responsive PKD, the phenotypic spectrum of PRRT2 mutations includes infantile convulsions and paroxysmal choreoathetosis, beneficial familial infantile seizures, hemiplegic migraine, a "PNKD-similar" syndrome, and PED (Liu et al., 2012; Gardiner et al., 2012).

Read total chapter

URL:

https://world wide web.sciencedirect.com/scientific discipline/commodity/pii/B978012405195900024X

Pancreatic ß-Jail cell Biology in Health and Affliction

Laura Sanchez Caballero , ... Mariana Igoillo-Esteve , in International Review of Cell and Molecular Biology, 2021

2.15.ane Genetic alteration and clinical phenotype

Homozygous nonsense or frameshift mutations in the NKX2.two gene coding for the transcription factor NKX2.2 cause permanent neonatal diabetes mellitus (Flanagan et al., 2014). Upwards to date, three patients from ii independent consanguineous families take been reported. The 3 patients had very important insulin secretion defects but no alterations in the exocrine pancreas office (Flanagan et al., 2014), and two of them also had several extrapancreatic manifestations including moderate to severe developmental delay affecting motor and intellectual function, hypotonia, bilateral hearing harm, cortical blindness and short stature among others (Flanagan et al., 2014).

Read full chapter

URL:

https://world wide web.sciencedirect.com/science/article/pii/S1937644821000101

GENETICS | Genetics of Lafora and Juvenile Myoclonic Epilepsies

A.V. Delgado-Escueta , in Encyclopedia of Basic Epilepsy Research, 2009

Gene replacement therapy is the future

For deletions, frameshifts, missense or nonsense mutations in laforin or malin, factor replacement treatment would exist the ideal treatment. Cornford and Hyman have successfully transported laforin across the blood–brain barrier of laforin-deficient KO mice after intravenous administration of an expression plasmid containing laforin packaged in the interior of neutral pegylated immunoliposomes (PIL). The external PIL is conjugated with OX26 monoclonal antibodies confronting transferrin receptor, which transports the vehicle across the blood–brain barrier. Presently, these investigators are administering PIL packaged with all four exons of laforin, with SV40 promotor, using mice epm2a polyclonal antibodies to confirm passage of epm2a through the blood–brain bulwark in exon iv KO homozygous null mutant mice. So far, laforin has been shown to rescue the pathology of LD in epm2a KO mice when administered in utero and in early on postnatal months. Laforin replacement is now being studied in older mice with Lafora affliction. In the most future, the same method of delivering epm2a/laforin can be applied to Laforin scarce humans.

Read total chapter

URL:

https://www.sciencedirect.com/scientific discipline/article/pii/B9780123739612000667

Neurogenetics, Function Ii

Leonel T. Takada , ... Michael D. Geschwind , in Handbook of Clinical Neurology, 2018

PRNP nonsense mutations

PRNP nonsense (or frameshift mutation leading to premature stop codon) mutations are very rare and cause gPrD with singular clinical and neuropathologic features, as discussed beneath. The pathogenic mechanisms underlying these mutations are notwithstanding unclear, but the lack of the GPI anchor in the truncated protein appears to play an important role ( Mead et al., 2013). Experiments with transgenic mice expressing anchorless PrP showed that not only tin they develop a transmissible PrP amyloidosis, but also that following infection by PrPSc, PrP deposition tin can exist constitute in extraneural tissues such every bit center, kidney, pancreas and gut (Stohr et al., 2011).

Read full chapter

URL:

https://www.sciencedirect.com/science/commodity/pii/B9780444640765000296

GPCR'due south and Endocrinology

Caroline M. Gorvin , in Reference Module in Biomedical Sciences, 2021

2.two.i Mutations in MC4R cause severe obesity in humans

In 1998, heterozygous frameshift mutations in MC4R were identified in ii cohorts of severely obese children (Yeo et al., 1998). After, ~   160 different loss-of-function mutations have been described and defects in MC4R are now recognized as the most common genetic crusade of obesity, associated with upward to half dozen% of cases (Farooqi et al., 2003). MC4R mutations have a dominant way of inheritance. The bulk of mutations are heterozygous, and individuals in which homozygous mutations have been identified have an earlier onset of severe obesity (Farooqi et al., 2003, 2000). Nearly of the MC4R mutations are missense, although nonsense, frameshift and small insertions and deletions have been described (Novoselova et al., 2018; Farooqi et al., 2003, 2000). In vitro expression of MC4R mutations demonstrates partially-dumb cAMP generation (Yeo et al., 2003). Defective cell surface expression is unremarkably observed for missense mutations and is due to retention in the endoplasmic reticulum (ER) (Yeo et al., 2003; Granell et al., 2010). The development of pharmacochaperones that improve protein folding or subtract ER degradation could be used as treatments in hereditary obesity (Granell et al., 2010).

In addition to early-onset obesity, patients with MC4R have tall stature, increased lean mass, high os mineral density, hyperphagia and hyperinsulinemia (Farooqi et al., 2003, 2000). Additionally, both humans and mice with MC4R deficiency have low blood pressure due to impaired sympathetic nervous system activation (Fan et al., 2000; Farooqi et al., 2003; Greenfield et al., 2009; Lotta et al., 2019). In overweight and obese humans without MC4R mutations, the infusion of a highly-selective MC4R agonist led to dose-dependent increases in blood pressure and heart rate (Greenfield et al., 2009), limiting the use of MC4R agonists for the treatment of obesity. More recently, modified agonists with reduced adverse effects on the cardiovascular organization have been developed which testify promise equally an obesity treatment (Chen et al., 2015; Kievit et al., 2013). Nevertheless, off-target effects on other melanocortin receptors have been observed and further modifications may be required (Chen et al., 2015).

In 2019, studies of MC4R mutations in >   50,000 individuals in the UK Biobank demonstrated that some individuals harbor variants that exhibit a gain-of-office and biased signaling to preferentially increase β-arrestin recruitment rather than military camp production (Lotta et al., 2019). Individuals with these variants had significantly lower BMI, and up to a 50% lower risk of obesity, blazon-2 diabetes and coronary artery disease (Lotta et al., 2019). Therefore the evolution of biased agonists for MC4R that favor β-arrestin recruitment may be required to better obesity treatments and limit off-target effects. The recent elucidation of the MC4R crystal construction may assist in designing small molecules that selectively bias MC4R signaling (Yu et al., 2020).

Read full chapter

URL:

https://world wide web.sciencedirect.com/science/article/pii/B9780128204726000207